PDB entry 1aay

View 1aay on RCSB PDB site
Description: zif268 zinc finger-DNA complex
Class: transcription/DNA
Keywords: zinc finger, DNA-binding protein, complex (zinc finger/DNA), transcription/DNA complex
Deposited on 1997-01-18, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.195
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (zif268 zinc finger peptide)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aaya1, d1aaya2, d1aaya3
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*cp*cp*ap*cp*gp*c)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1aayA (A:)
merpyacpvescdrrfsrsdeltrhirihtgqkpfqcricmrnfsrsdhltthirthtge
kpfacdicgrkfarsderkrhtkihlrqkd

    Sequence, based on observed residues (ATOM records): (download) 
    >1aayA (A:)
rpyacpvescdrrfsrsdeltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
facdicgrkfarsderkrhtkihlr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.