PDB entry 1aap

View 1aap on RCSB PDB site
Description: x-ray crystal structure of the protease inhibitor domain of alzheimer's amyloid beta-protein precursor
Deposited on 1990-09-14, released 1991-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1992-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1aapa_
  • Chain 'B':
    Domains in SCOP 1.59: d1aapb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aapA (A:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aapB (B:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg