PDB entry 1aap

View 1aap on RCSB PDB site
Description: x-ray crystal structure of the protease inhibitor domain of alzheimer's amyloid beta-protein precursor
Class: proteinase inhibitor (trypsin)
Keywords: proteinase inhibitor (trypsin)
Deposited on 1990-09-14, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alzheimer's disease amyloid a4 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aapa_
  • Chain 'B':
    Compound: alzheimer's disease amyloid a4 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aapb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1aapA (A:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsa

    Sequence, based on observed residues (ATOM records): (download) 
    >1aapA (A:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1aapB (B:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsa

    Sequence, based on observed residues (ATOM records): (download) 
    >1aapB (B:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg