PDB entry 1aan

View 1aan on RCSB PDB site
Description: crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1992-04-09, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1aana_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aanA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve