PDB entry 1aal
View 1aal on RCSB PDB site
Description: structural effects induced by mutagenesis affected by crystal packing factors: the structure of a 30-51 disulfide mutant of basic pancreatic trypsin inhibitor
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on
1992-04-09, released
1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated
1993-10-31, with a file datestamp of
2007-06-04.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus
Database cross-references and differences (RAF-indexed):
- Uniprot P00974 (0-57)
- conflict (29)
- conflict (50)
Domains in SCOP 1.73: d1aala_ - Chain 'B':
Compound: bovine pancreatic trypsin inhibitor
Species: Bos taurus
Database cross-references and differences (RAF-indexed):
- Uniprot P00974 (0-End)
- conflict (29)
- conflict (50)
Domains in SCOP 1.73: d1aalb_ - Heterogens: PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1aalA (A:)
rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgga
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1aalB (B:)
rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgga
Sequence, based on observed residues (ATOM records): (download)
>1aalB (B:)
rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgg