PDB entry 1aal

View 1aal on RCSB PDB site
Description: structural effects induced by mutagenesis affected by crystal packing factors: the structure of a 30-51 disulfide mutant of basic pancreatic trypsin inhibitor
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1992-04-09, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bovine pancreatic trypsin inhibitor
  Species: Bos taurus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • conflict (29)
    • conflict (50)
  Domains in SCOP 1.73: d1aala_
• Chain 'B':
  Compound: bovine pancreatic trypsin inhibitor
  Species: Bos taurus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-End)
    • conflict (29)
    • conflict (50)
  Domains in SCOP 1.73: d1aalb_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aalA (A:)
  rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgga
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1aalB (B:)
  rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgga
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1aalB (B:)
  rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgg