PDB entry 1aal

View 1aal on RCSB PDB site
Description: structural effects induced by mutagenesis affected by crystal packing factors: the structure of a 30-51 disulfide mutant of basic pancreatic trypsin inhibitor
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1992-04-09, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • conflict (29)
      • conflict (50)
    Domains in SCOPe 2.08: d1aala_
  • Chain 'B':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-End)
      • conflict (29)
      • conflict (50)
    Domains in SCOPe 2.08: d1aalb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aalA (A:)
    rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aalB (B:)
    rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aalB (B:)
    rpdfcleppytgpckariiryfynakaglvqtfvyggcrakrnnfksaedamrtcgg