PDB entry 1aak

View 1aak on RCSB PDB site
Description: three-dimensional structure of a ubiquitin-conjugating enzyme (e2)
Deposited on 1992-04-08, released 1993-10-31
The last revision was dated 1993-10-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1aak_ (-)
    mstparkrlmrdfkrlqqdppagisgapqdnnimlwnavifgpddtpwdggtfklslqfs
    edypnkpptvrfvsrmfhpniyadgsicldilqnqwspiydvaailtsiqsllcdpnpns
    panseaarmyseskreynrrvrdvveqswtad
    

    Sequence, based on observed residues (ATOM records):
    >1aak_ (-)
    mstparkrlmrdfkrlqqdppagisgapqdnnimlwnavifgpddtpwdggtfklslqfs
    edypnkpptvrfvsrmfhpniyadgsicldilqnqwspiydvaailtsiqsllcdpnpns
    panseaarmyseskreynrrvrdvveqswta
    

  • Chain 'p':
    No sequence available.