PDB entry 1aaj

View 1aaj on RCSB PDB site
Description: crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Deposited on 1992-04-09, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1aaj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aaj_ (-)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve