PDB entry 1aaf

View 1aaf on RCSB PDB site
Description: nucleocapsid zinc fingers detected in retroviruses: exafs studies on intact viruses and the solution-state structure of the nucleocapsid protein from hiv-1
Class: Viral protein
Keywords: Viral protein
Deposited on 1992-04-06, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 nucleocapsid protein
    Species: Human immunodeficiency virus 1 [TaxId:11696]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aafa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aafA (A:)
    mqrgnfrnqrkiikcfncgkeghiakncraprkrgcwkcgkeghqmkdcterqan