PDB entry 1aac

View 1aac on RCSB PDB site
Description: amicyanin oxidized, 1.31 angstroms
Class: electron transport
Keywords: electron transport
Deposited on 1995-09-07, released 1996-03-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.155
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans [TaxId:266]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
  Domains in SCOPe 2.01: d1aaca_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aacA (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve