PDB entry 1aac

View 1aac on RCSB PDB site
Description: amicyanin oxidized, 1.31 angstroms
Deposited on 1995-09-07, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.155
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1aac__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aac_ (-)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve