PDB entry 1aab

View 1aab on RCSB PDB site
Description: nmr structure of rat hmg1 hmga fragment
Deposited on 1995-10-28, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR33
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1aab__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aab_ (-)
    gkgdpkkprgkmssyaffvqtsreehkkkhpdasvnfsefskkcserwktmsakekgkfe
    dmakadkaryeremktyippkge