PDB entry 1aab

View 1aab on RCSB PDB site
Description: nmr structure of rat hmg1 hmga fragment
Class: DNA-binding
Keywords: hmg-box, DNA-binding
Deposited on 1995-10-28, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high mobility group protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63159 (0-82)
    • engineered (21)
  Domains in SCOPe 2.08: d1aaba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aabA (A:)
  gkgdpkkprgkmssyaffvqtsreehkkkhpdasvnfsefskkcserwktmsakekgkfe
  dmakadkaryeremktyippkge