PDB entry 1aa8

View 1aa8 on RCSB PDB site
Description: porcine kidney d-amino acid oxidase
Class: oxidase
Keywords: fad, oxidase, d-amino acid
Deposited on 1997-01-25, released 1997-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 1997-04-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid oxidase
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aa8a3, d1aa8a4
  • Chain 'B':
    Compound: d-amino acid oxidase
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aa8b3, d1aa8b4
  • Heterogens: FAD, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aa8A (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa8A (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aa8B (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa8B (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernll