PDB entry 1aa7

View 1aa7 on RCSB PDB site
Description: influenza virus matrix protein crystal structure at ph 4.0
Deposited on 1997-01-24, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1aa7a_
  • Chain 'B':
    Domains in SCOP 1.55: d1aa7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa7A (A:)
    mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
    gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys
    agalascmgliynrmgavttevafglvcatceqiadsq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa7B (B:)
    slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
    fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
    galascmgliynrmgavttevafglvcatceqiadsq