PDB entry 1aa7

View 1aa7 on RCSB PDB site
Description: influenza virus matrix protein crystal structure at ph 4.0
Class: matrix protein
Keywords: viral assembly, virion budding, transcription repressor, matrix protein
Deposited on 1997-01-24, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: influenza virus matrix protein
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aa7a_
  • Chain 'B':
    Compound: influenza virus matrix protein
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aa7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa7A (A:)
    mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
    gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys
    agalascmgliynrmgavttevafglvcatceqiadsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aa7B (B:)
    mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
    gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys
    agalascmgliynrmgavttevafglvcatceqiadsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aa7B (B:)
    slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
    fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
    galascmgliynrmgavttevafglvcatceqiadsq