PDB entry 1aa2

View 1aa2 on RCSB PDB site
Description: calponin homology (ch) domain from human beta-spectrin
Class: cytoskeleton
Keywords: spectrin, cytoskeleton, f-actin cross-linking
Deposited on 1997-01-21, released 1998-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-spectrin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01082 (0-107)
  Domains in SCOPe 2.08: d1aa2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aa2A (A:)
  ksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnahy
  nlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfskm