PDB entry 1a9z

View 1a9z on RCSB PDB site
Description: udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-galactose
Class: epimerase
Keywords: epimerase, galactose metabolism, dehydrogenase
Deposited on 1998-04-14, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose 4-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09147 (0-337)
      • engineered (123)
      • conflict (130)
      • engineered (148)
    Domains in SCOPe 2.07: d1a9za_
  • Heterogens: NA, NAD, UPG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9zA (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fssaatvygdnpkipyvesfptgtpqspfgksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd