PDB entry 1a9y

View 1a9y on RCSB PDB site
Description: udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose
Class: epimerase
Keywords: epimerase, galactose metabolism, dehydrogenase
Deposited on 1998-04-14, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose 4-epimerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09147 (0-337)
      • engineered (123)
      • engineered (148)
    Domains in SCOPe 2.07: d1a9ya_
  • Heterogens: NA, NAD, UPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9yA (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fssaatvygdqpkipyvesfptgtpqspfgksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd