PDB entry 1a9x

View 1a9x on RCSB PDB site
Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis
Deposited on 1998-04-14, released 1998-10-21
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-21, with a file datestamp of 1998-10-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xB (B:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xD (D:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xF (F:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xH (H:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt