PDB entry 1a9v

View 1a9v on RCSB PDB site
Description: tertiary structure of the major house dust mite allergen der p 2, nmr, 10 structures
Deposited on 1998-04-10, released 1998-10-14
The last revision prior to the SCOP 1.67 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1a9v__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9v_ (-)
    sqvdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
    levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
    iathakird