PDB entry 1a9v

View 1a9v on RCSB PDB site
Description: tertiary structure of the major house dust mite allergen der p 2, nmr, 10 structures
Class: allergen
Keywords: allergen, immunoglobulin fold
Deposited on 1998-04-10, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mite allergen der p 2
    Species: Dermatophagoides pteronyssinus [TaxId:6956]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a9va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9vA (A:)
    sqvdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
    levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
    iathakird