PDB entry 1a9u

View 1a9u on RCSB PDB site
Description: the complex structure of the map kinase p38/sb203580
Class: transferase
Keywords: transferase, map kinase, serine/threonine-protein kinase, p38
Deposited on 1998-04-10, released 1999-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: map kinase p38
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a9ua_
  • Heterogens: SB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a9uA (A:)
    gsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaa
    fdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefnd
    vylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavned
    celkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrt
    lfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganpla
    vdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewkslt
    ydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9uA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld