PDB entry 1a9u

View 1a9u on RCSB PDB site
Description: the complex structure of the map kinase p38/sb203580
Deposited on 1998-04-10, released 1999-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a9u__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9u_ (-)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld