PDB entry 1a9t

View 1a9t on RCSB PDB site
Description: bovine purine nucleoside phosphorylase complexed with 9-deazainosine and phosphate
Class: transferase
Keywords: transferase, glycosyltransferase, pentosyltransferase, purine nucleoside phosphorylase
Deposited on 1998-04-10, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55859 (0-283)
      • conflict (1)
      • conflict (248)
    Domains in SCOPe 2.08: d1a9ta_
  • Heterogens: R1P, HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9tA (A:)
    mangytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipv