PDB entry 1a9p

View 1a9p on RCSB PDB site
Description: bovine purine nucleoside phosphorylase complexed with 9-deazainosine and phosphate
Class: pentosyltransferase
Keywords: pentosyltransferase, purine nucleoside phosphorylase
Deposited on 1998-04-10, released 1998-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55859 (0-288)
      • conflict (248)
    Domains in SCOPe 2.08: d1a9pa_
  • Heterogens: PO4, 9DI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9pA (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipvsghtg