PDB entry 1a9o

View 1a9o on RCSB PDB site
Description: bovine purine nucleoside phosphorylase complexed with phosphate
Class: pentosyltransferase
Keywords: pentosyltransferase, purine nucleoside phosphorylase
Deposited on 1998-04-10, released 1998-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55859 (0-288)
      • conflict (248)
    Domains in SCOP 1.75: d1a9oa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9oA (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipvsghtg