PDB entry 1a9m

View 1a9m on RCSB PDB site
Description: g48h mutant of hiv-1 protease in complex with a peptidic inhibitor u-89360e
Class: aspartyl protease
Keywords: aspartyl protease, drug resistant, mutation
Deposited on 1998-04-08, released 1998-06-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368 (0-98)
    • engineered (47)
  Domains in SCOPe 2.04: d1a9ma_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368 (0-98)
    • engineered (47)
  Domains in SCOPe 2.04: d1a9mb_
• Heterogens: U0E, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a9mA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a9mB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmihgiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf