PDB entry 1a9d

View 1a9d on RCSB PDB site
Description: crystal structure of murine class I MHC h2-db complexed with a synthetic peptide p1027
Class: complex (MHC I/peptide)
Keywords: complex (MHC I/peptide), signal, transmembrane, glycoprotein
Deposited on 1998-04-05, released 1998-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 1998-06-17, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.241
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I MHC
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a9da1, d1a9da2
  • Chain 'B':
    Compound: class I MHC
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 1A9D (1-9)
    • Uniprot P01887 (1-99)
    Domains in SCOPe 2.06: d1a9db1, d1a9db2
  • Chain 'C':
    Compound: peptide p1027 (fapgvfpym)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a9dA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrwerwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9dA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9dB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.