PDB entry 1a99

View 1a99 on RCSB PDB site
Description: putrescine receptor (potf) from e. coli
Class: binding protein
Keywords: binding protein, transport, periplasmic putrescine binding protein (potf)
Deposited on 1998-04-17, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putrescine-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: PUCPOTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a99a_
  • Chain 'B':
    Compound: putrescine-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: PUCPOTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a99b_
  • Chain 'C':
    Compound: putrescine-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: PUCPOTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a99c_
  • Chain 'D':
    Compound: putrescine-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: PUCPOTF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a99d_
  • Heterogens: PUT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a99A (A:)
    aeqktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsa
    sflerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdk
    vkavlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddy
    tgpatdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsf
    sipkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvs
    aevrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a99A (A:)
    qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
    lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
    avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
    patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
    pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
    vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a99B (B:)
    aeqktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsa
    sflerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdk
    vkavlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddy
    tgpatdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsf
    sipkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvs
    aevrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a99B (B:)
    qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
    lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
    avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
    patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
    pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
    vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a99C (C:)
    aeqktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsa
    sflerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdk
    vkavlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddy
    tgpatdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsf
    sipkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvs
    aevrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a99C (C:)
    qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
    lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
    avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
    patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
    pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
    vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a99D (D:)
    aeqktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsa
    sflerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdk
    vkavlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddy
    tgpatdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsf
    sipkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvs
    aevrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a99D (D:)
    qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
    lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
    avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
    patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
    pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
    vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg