PDB entry 1a98

View 1a98 on RCSB PDB site
Description: xprtase from e. coli complexed with gmp
Class: phosphoribosyltransferase
Keywords: phosphoribosyltransferase, transferase, purine salvage enzyme, glycosyltransferase
Deposited on 1998-04-16, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthine-guanine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GPT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M5 (Start-151)
      • engineered (58)
    Domains in SCOPe 2.07: d1a98a_
  • Chain 'B':
    Compound: xanthine-guanine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GPT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M5
      • engineered (58)
    Domains in SCOPe 2.07: d1a98b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a98A (A:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvai
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a98A (A:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvaigd
    gegfividdlvdtavairemypkahfvtifakpagrplvddyvvdipqdtwieqpwdmgv
    vfvppisgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a98B (B:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvai
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a98B (B:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvaisg
    egfividdlvdttavairemypkahfvtifakpagrplvddyvvdipqdtwieqpwdmgv
    vfvppis