PDB entry 1a96

View 1a96 on RCSB PDB site
Description: xprtase from e. coli with bound cprpp and xanthine
Class: phosphoribosyltransferase
Keywords: phosphoribosyltransferase, transferase, purine salvage enzyme, glycosyltransferase
Deposited on 1998-04-16, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthine-guanine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GPT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a96a_
  • Chain 'B':
    Compound: xanthine-guanine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GPT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a96b_
  • Chain 'C':
    Compound: xanthine-guanine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GPT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a96c_
  • Chain 'D':
    Compound: xanthine-guanine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GPT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a96d_
  • Heterogens: MG, PCP, XAN, BO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a96A (A:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a96A (A:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    ynqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplvddy
    vvdipqdtwieqpwdmgvvfvppis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a96B (B:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a96B (B:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
    ddyvvdipqdtwieqpwdmgvvfvppisgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a96C (C:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a96C (C:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
    ddyvvdipqdtwieqpwdmgvvfvppisgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a96D (D:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a96D (D:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    yrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplvddyvv
    dipqdtwieqpwdmgvvfvppisgr