PDB entry 1a91

View 1a91 on RCSB PDB site
Description: subunit c of the f1fo ATP synthase of escherichia coli; nmr, 10 structures
Class: membrane protein
Keywords: membrane protein, hydrogen ion transport
Deposited on 1998-04-15, released 1998-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f1fo ATPase subunit c
    Species: Escherichia coli [TaxId:562]
    Gene: UNCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a91a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a91A (A:)
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava