PDB entry 1a90

View 1a90 on RCSB PDB site
Description: recombinant mutant chicken egg white cystatin, nmr, 31 structures
Class: thiol protease inhibitor
Keywords: proteinase inhibitor, thiol proteinase, steffins, kininogens, thiol protease inhibitor
Deposited on 1998-04-14, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cystatin
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01038 (0-107)
  Domains in SCOPe 2.08: d1a90a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a90A (A:)
  gapvpvdendeglqralqfaiaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
  ttcpkssgdlqscefhdepelakyttctfvvysipwlnqiklleskcq