PDB entry 1a90

View 1a90 on RCSB PDB site
Description: recombinant mutant chicken egg white cystatin, nmr, 31 structures
Class: thiol protease inhibitor
Keywords: proteinase inhibitor, thiol proteinase, steffins, kininogens, thiol protease inhibitor
Deposited on 1998-04-14, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystatin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a90a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a90A (A:)
    gapvpvdendeglqralqfaiaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
    ttcpkssgdlqscefhdepelakyttctfvvysipwlnqiklleskcq