PDB entry 1a8z

View 1a8z on RCSB PDB site
Description: structure determination of a 16.8kda copper protein rusticyanin at 2.1a resolution using anomalous scattering data with direct methods
Class: electron transport
Keywords: direct methods, sas, medium resolution, metalloprotein, copper protein, electron transport
Deposited on 1998-03-30, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rusticyanin
    Species: Acidithiobacillus ferrooxidans [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24930 (0-152)
      • conflict (2-3)
      • conflict (17)
      • conflict (62)
      • conflict (88)
      • conflict (90)
      • conflict (93)
      • conflict (121)
      • conflict (150)
    Domains in SCOPe 2.08: d1a8za_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8zA (A:)
    ldtswkeatlpqvkamlqkdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp
    tldipagatvdvtfintnkgfghsfditqktppfavmpvidpivagtgfspvpkdgkfgy
    tnftwhptagtyyyvcqipghaatgmfgkivvk