PDB entry 1a8y

View 1a8y on RCSB PDB site
Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution
Class: calcium-binding protein
Keywords: calsequestrin, calcium-binding protein, sarcoplasmic reticulum, rabbit skeletal muscle
Deposited on 1998-03-31, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calsequestrin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a8ya1, d1a8ya2, d1a8ya3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a8yA (A:)
    eegldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilel
    aaqvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlvefll
    dvledpveliegerelqafeniedeikligyfknkdsehykafkeaaeefhpyipffatf
    dskvakkltlklneidfyeafmeepvtipdkpnseeeivnfveehrrstlrklkpesmye
    tweddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwidpddfpllvpywe
    ktfdidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvlegeintedddded
    ddddddd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8yA (A:)
    gldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilelaa
    qvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlveflldv
    ledpveliegerelqafeniedeikligyfknkdsehykafkeaaeefhpyipffatfds
    kvakkltlklneidfyeafmeepvtipdkpnseeeivnfveehrrstlrklkpesmyetw
    eddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwidpddfpllvpywekt
    fdidlsapqigvvnvtdadsvwmepsaeeledwledvl