PDB entry 1a8v

View 1a8v on RCSB PDB site
Description: structure of the RNA-binding domain of the rho transcription terminator
Class: transcription termination
Keywords: transcription termination, RNA-binding, terminator, rho protein
Deposited on 1998-03-28, released 1999-05-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1a8va1, d1a8va2
  • Chain 'B':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1a8vb1, d1a8vb2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a8vA (A:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8vA (A:)
    ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
    qdgfgflrsaagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a8vB (B:)
    mghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvlei
    lqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvn
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8vB (B:)
    ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
    qdgfgflrsadagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne