PDB entry 1a8u

View 1a8u on RCSB PDB site
Description: chloroperoxidase t/benzoate complex
Class: haloperoxidase
Keywords: haloperoxidase, oxidoreductase, benzoate complex
Deposited on 1998-03-26, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.149
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase t
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: CPOT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a8ua_
  • Chain 'B':
    Compound: chloroperoxidase t
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: CPOT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a8ub_
  • Heterogens: SO4, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8uA (A:)
    pfitvgqenstsidlyyedhgagqpvvlihgfplsghswerqsaalldagyrvitydrrg
    fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
    flaslepfllktddnpdgaapkeffdgivaavkadryafytgffndfynldenlgtrise
    eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
    hkalpsaeyvevegaphgllwthaeevntallaflak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8uB (B:)
    pfitvgqenstsidlyyedhgagqpvvlihgfplsghswerqsaalldagyrvitydrrg
    fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
    flaslepfllktddnpdgaapkeffdgivaavkadryafytgffndfynldenlgtrise
    eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
    hkalpsaeyvevegaphgllwthaeevntallaflak