PDB entry 1a8s

View 1a8s on RCSB PDB site
Description: chloroperoxidase f/propionate complex
Class: haloperoxidase
Keywords: haloperoxidase, oxidoreductase, propionate complex
Deposited on 1998-03-27, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase f
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: CPOF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a8sa_
  • Heterogens: SO4, PPI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a8sA (A:)
ttfttrdgtqiyykdwgsgqpivfshgwplnadswesqmiflaaqgyrviahdrrghgrs
sqpwsgndmdtyaddlaqliehldlrdavlfgfstgggevaryigrhgtarvakaglisa
vpplmlkteanpgglpmevfdgirqasladrsqlykdlasgpffgfnqpgakssagmvdw
fwlqgmaaghknaydcikafsetdftedlkkidvptlvvhgdadqvvpieasgiasaalv
kgstlkiysgaphgltdthkdqlnadllafikg