PDB entry 1a8r

View 1a8r on RCSB PDB site
Description: GTP cyclohydrolase I (h112s mutant) in complex with GTP
Class: hydrolase
Keywords: hydrolase, GTP, purine hydrolysis, pterine synthesis
Deposited on 1998-03-27, released 1999-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8ra_
  • Chain 'B':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rb_
  • Chain 'C':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rc_
  • Chain 'D':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rd_
  • Chain 'E':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8re_
  • Chain 'F':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rf_
  • Chain 'G':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rg_
  • Chain 'H':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rh_
  • Chain 'I':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8ri_
  • Chain 'J':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rj_
  • Chain 'K':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rk_
  • Chain 'L':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rl_
  • Chain 'M':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rm_
  • Chain 'N':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8rn_
  • Chain 'O':
    Compound: GTP cyclohydrolase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T5 (0-220)
      • mutation (111)
    Domains in SCOPe 2.07: d1a8ro_
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rA (A:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rB (B:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rC (C:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rD (D:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rE (E:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rF (F:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rG (G:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rH (H:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rI (I:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rJ (J:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rK (K:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rL (L:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rM (M:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rN (N:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8rO (O:)
    pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
    etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
    atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
    cvkargirdatsattttslgglfkssqntrheflravrhhn