PDB entry 1a8o

View 1a8o on RCSB PDB site
Description: hiv capsid c-terminal domain
Deposited on 1998-03-27, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-28, with a file datestamp of 1998-10-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1a8o__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a8o_ (-)
  mdirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpgat
  leemmtacqg