PDB entry 1a8o

View 1a8o on RCSB PDB site
Description: hiv capsid c-terminal domain
Class: Viral protein
Keywords: CAPSID, CORE PROTEIN, HIV, C-TERMINAL DOMAIN, Viral protein
Deposited on 1998-03-27, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a8oa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8oA (A:)
    mdirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpgat
    leemmtacqg