PDB entry 1a8l

View 1a8l on RCSB PDB site
Description:
Deposited on 1998-03-26, released 1999-03-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1a8l_1, d1a8l_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8l_ (-)
    mglisdadkkvikeeffskmvnpvklivfvrkdhcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelakryridrapattitqdgkdfgvryfglpaghefaafledivdvsreetn
    lmdetkqairnidqdvrilvfvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedrvefegaypekmflekllsals