PDB entry 1a8l

View 1a8l on RCSB PDB site
Description: protein disulfide oxidoreductase from archaeon pyrococcus furiosus
Class: oxidoreductase
Keywords: oxidoreductase, pdi, thioredoxin fold
Deposited on 1998-03-26, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein disulfide oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a8la1, d1a8la2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8lA (A:)
    mglisdadkkvikeeffskmvnpvklivfvrkdhcqycdqlkqlvqelseltdklsyeiv
    dfdtpegkelakryridrapattitqdgkdfgvryfglpaghefaafledivdvsreetn
    lmdetkqairnidqdvrilvfvtptcpycplavrmahkfaientkagkgkilgdmveaie
    ypewadqynvmavpkiviqvngedrvefegaypekmflekllsals