PDB entry 1a8j

View 1a8j on RCSB PDB site
Description: immunoglobulin lambda light chain dimer (mcg) complex with aspartame
Class: immunoglobulin
Keywords: aspartame, ligand binding, immunotherapeutic agent, surrogate receptor, mcg(human) bence-jones dimer, immunoglobulin
Deposited on 1998-03-26, released 1998-06-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin lambda light chain dimer (mcg)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d1a8jh1, d1a8jh2
  • Chain 'L':
    Compound: immunoglobulin lambda light chain dimer (mcg)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.03: d1a8jl1, d1a8jl2
  • Heterogens: PME

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8jH (H:)
    esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8jL (L:)
    esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs