PDB entry 1a8i

View 1a8i on RCSB PDB site
Description: spirohydantoin inhibitor of glycogen phosphorylase
Class: glycogen phosphorylase
Keywords: glycogen phosphorylase, glucopyranose spirohydantoin, water structure, inhibitor binding, anti-hyperglycemic agent
Deposited on 1998-03-25, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogen phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • see remark 999 (379)
      • modified residue (679)
    Domains in SCOPe 2.07: d1a8ia_
  • Heterogens: GLS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a8iA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8iA (A:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapngyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksskf
    rtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipe
    alerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinma
    hlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaei
    iaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnsl
    fdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikl
    itaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqii
    eqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvi
    rniatsgkfssdrtiaqyareiwgvepsrqrlp