PDB entry 1a8g

View 1a8g on RCSB PDB site
Description: hiv-1 protease in complex with sdz283-910
Deposited on 1998-03-24, released 1998-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.15
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a8ga_
  • Chain 'B':
    Domains in SCOP 1.55: d1a8gb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8gA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8gB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf