PDB entry 1a8e

View 1a8e on RCSB PDB site
Description: human serum transferrin, recombinant n-terminal lobe
Class: iron transport
Keywords: iron transport, glycoprotein, transferrin, nlobe, iron-release, carbonate
Deposited on 1998-03-24, released 1998-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum transferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a8ea_
  • Heterogens: CO3, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8eA (A:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc