PDB entry 1a8d

View 1a8d on RCSB PDB site
Description: tetanus toxin c fragment
Class: neurotoxin
Keywords: neurotoxin, clostridial, ganglioside binding region
Deposited on 1998-03-23, released 1998-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.187
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetanus neurotoxin
    Species: Clostridium tetani [TaxId:1513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1a8da1, d1a8da2
  • Heterogens: AU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8dA (A:)
    mknldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkai
    hlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkh
    slsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlss
    anlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiek
    lytsylsitflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngkln
    iyyrrlynglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldr
    ilrvgynapgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdi
    liasnwyfnhlkdkilgcdwyfvptdegwtnd