PDB entry 1a8b

View 1a8b on RCSB PDB site
Description: rat annexin v complexed with glycerophosphoethanolamine
Class: calcium binding protein
Keywords: phospholipid analog, calcium binding protein, membrane binding protein
Deposited on 1998-03-23, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin v
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a8ba_
  • Heterogens: CA, GPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a8bA (A:)
    alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
    dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
    aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
    elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
    irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
    tsgdykkallllcggedd